PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g062840.2.1
Common NameNAM
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 353aa    MW: 39510.4 Da    PI: 8.3468
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g062840.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.5e-55161431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL kkv + ++++ ++i+evd++k+ePw+Lp k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e
  Solyc07g062840.2.1  16 LPPGFRFHPTDEELITYYLLKKVLDCNFTA-RAIAEVDLNKCEPWELPGKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDRE 105
                         79*************************999.89***************99999************************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ + +lvg+kktLvfy+grapkgek++Wvmheyrl
  Solyc07g062840.2.1 106 IFSSkTCALVGMKKTLVFYRGRAPKGEKSNWVMHEYRL 143
                         **9745567***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-647168IPR003441NAC domain
PROSITE profilePS5100559.81916168IPR003441NAC domain
PfamPF023651.5E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020042anatomysimple leaf
PO:0020148anatomyshoot apical meristem
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MEIYHQMQFD CGDPHLPPGF RFHPTDEELI TYYLLKKVLD CNFTARAIAE VDLNKCEPWE  60
LPGKAKMGEK EWYFFSLRDR KYPTGLRTNR ATEAGYWKAT GKDREIFSSK TCALVGMKKT  120
LVFYRGRAPK GEKSNWVMHE YRLDGKFAYH YISRSSKDEW VISRVFQKST GSNGAATSTG  180
GGKKRLSSSI NMYQEVSSPS SVSHLPPLLD SSPYSTTATS AAAIVIGDRD RDHSFKKEHV  240
PCFSTTATAT ITAQSLTFDP TSVFDISSNT LHALQPTPSF ASILDSSPSN FTNYTRNSTF  300
PSLRSLHENL QLPLFSGGTS AMHGGFSNPM VNWTVPETQK VEQSELDCMW SY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-531617317170NO APICAL MERISTEM PROTEIN
1ut4_B8e-531617317170NO APICAL MERISTEM PROTEIN
1ut7_A8e-531617317170NO APICAL MERISTEM PROTEIN
1ut7_B8e-531617317170NO APICAL MERISTEM PROTEIN
4dul_A8e-531617317170NAC domain-containing protein 19
4dul_B8e-531617317170NAC domain-containing protein 19
Search in ModeBase
Function -- GeneRIF ? help Back to Top
  1. ENTIRE and GOBLET inhibit auxin response and specify primary leaflet initiation via redundant pathways.
    [PMID: 22332729]
  2. Initiation of ectopic meristems is dependent on the activities of the transcriptional regulators Goblet (Gob) and Lateral suppressor (Ls), specifically expressed in the distal (DLB) leaflet boundaries.
    [PMID: 25641652]
  3. CLAUSA restricts tomato leaf morphogenesis and GOBLET expression.
    [PMID: 26189897]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4351630.0Solanum lycopersicum NO APICAL MERISTEM (NAM) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234254.10.0NO APICAL MERISTEM
SwissprotO040171e-115NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLB8XS010.0B8XS01_SOLLC; Goblet
STRINGSolyc07g062840.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-106NAC family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Blein T, et al.
    A conserved molecular framework for compound leaf development.
    Science, 2008. 322(5909): p. 1835-9
    [PMID:19095941]
  3. Berger Y, et al.
    The NAC-domain transcription factor GOBLET specifies leaflet boundaries in compound tomato leaves.
    Development, 2009. 136(5): p. 823-32
    [PMID:19176589]
  4. Ben-Gera H, et al.
    ENTIRE and GOBLET promote leaflet development in tomato by modulating auxin response.
    Plant J., 2012. 70(6): p. 903-15
    [PMID:22332729]
  5. Rossmann S,Kohlen W,Hasson A,Theres K
    Lateral suppressor and Goblet act in hierarchical order to regulate ectopic meristem formation at the base of tomato leaflets.
    Plant J., 2015. 81(6): p. 837-48
    [PMID:25641652]
  6. Bar M,Ben-Herzel O,Kohay H,Shtein I,Ori N
    CLAUSA restricts tomato leaf morphogenesis and GOBLET expression.
    Plant J., 2015. 83(5): p. 888-902
    [PMID:26189897]